Key facts
- Peptide definition
- Chain of amino acids linked by peptide (amide) bonds
- Smallest peptide
- Dipeptide: 2 amino acids, 1 peptide bond
- Typical size used in practice
- About 2 to 50 residues (a convention, not a rule)
- Bonds in a linear chain
- n amino acids give n - 1 peptide bonds
- Written direction
- N-terminus to C-terminus, left to right
- Identity confirmed by
- Sequence, mass spectrometry and HPLC
Peptide Definition in One Sentence
The textbook peptide definition is short: a peptide is a molecule made of two or more amino acids linked in a chain by peptide bonds, with a defined order called its sequence [1][2].
Three ideas are packed into that peptide definition. The building blocks are amino acids, mostly the 20 standard alpha-amino acids, although synthetic peptides can also carry non-standard or D-form residues. The links between them are peptide bonds: amide bonds that form when the carboxyl group of one amino acid joins the amino group of the next, releasing a molecule of water. And order matters. Put the same amino acids in a different order and you have a different molecule.
Here we stick to the short peptide definition. The longer guide, What Are Peptides?, covers natural vs synthetic peptides, how they are made and why researchers study them.
What Is a Peptide Made Of?
Under a strict peptide definition, a peptide is built from amino acid residues. A residue is what remains of an amino acid after it gives up the atoms of water used to form the bonds on either side of it.
Each residue adds the same backbone unit (an amino nitrogen, an alpha carbon and a carbonyl carbon) plus its own side chain. The backbone simply repeats. The side chains change from one residue to the next, and they give the peptide its chemical character. At one end of the chain sits a free amino group (the N-terminus) and at the other a free carboxyl group (the C-terminus), unless either end has been chemically modified [1].
Since every peptide bond costs one water molecule, you get a peptide's mass by adding up its amino acid masses and subtracting 18.02 g/mol per bond. A linear chain of n residues has n - 1 peptide bonds. The peptide bond article explains the chemistry of that link in detail.
Peptide vs Polypeptide vs Protein
All three words describe the same kind of chain. What changes is size and level of organization, and the boundaries between them are conventions, not fixed rules.
| Term | Typical meaning | Example |
|---|---|---|
| Peptide | Short chain, roughly 2 to 50 residues | KPV (3), BPC-157 (15), MOTS-c (16) |
| Oligopeptide | A peptide of only a few residues | Tripeptides such as GHK or glutathione |
| Polypeptide | Any long, unbranched chain of residues | Each of the two chains of insulin |
| Protein | One or more polypeptides with a functional folded structure | Insulin, thymosin beta-4 (43), titin |
The IUPAC-IUB peptide definition is structural and sets no size cut-off [2]. Chemists and regulators tend to draw the peptide and protein line somewhere around 40 to 50 residues, yet exceptions are easy to find. Thymosin beta-4 has 43 amino acids and is routinely called a protein. Our polypeptide guide and Peptides vs. Proteins look at where the line falls in more depth.
How Big Is a Peptide?
Most compounds called peptides have between 2 and about 50 amino acids. In mass terms, that runs from under 200 g/mol up to roughly 5,000 to 6,000 g/mol.
Size names follow Greek number prefixes: a dipeptide has two residues, a tripeptide three, a tetrapeptide four, a pentapeptide five, and so on up to a pentadecapeptide at fifteen. The prefix counts residues, not bonds. For the detail on how many amino acids are in a peptide and why the cut-offs are fuzzy, there is a separate article, plus a companion piece that sets dipeptides, tripeptides and polypeptides side by side.
Examples of Peptides
The peptide definition is easier to see in real compounds. Every example below comes from the Vinnix Compound Library, with data as listed in PubChem.
| Compound | Residues | Sequence or structure |
|---|---|---|
| KPV | 3 | Lys-Pro-Val (KPV) |
| Glutathione | 3 | gamma-Glu-Cys-Gly (side-chain linked) |
| SS-31 | 4 | D-Arg-Dmt-Lys-Phe-NH2 |
| Ipamorelin | 5 | Aib-His-D-2-Nal-D-Phe-Lys-NH2 |
| BPC-157 | 15 | GEPPPGKPADDAGLV |
| MOTS-c | 16 | MRWQEMGYIFYPRKLR [3] |
| Sermorelin | 29 | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
Several entries use non-standard building blocks (Aib, Dmt, D-amino acids) or modified ends (-NH2). They are still peptides. What makes a molecule a peptide is the amide-linked chain, and nothing in the peptide definition requires every residue to be one of the standard 20.
Terms Often Confused With Peptide
Most of the mix-ups around the word peptide come from four neighboring terms.
- Amino acid vs peptide. A single amino acid is a monomer. It only becomes part of a peptide once a peptide bond joins it to at least one other amino acid.
- Peptide bond vs peptide. The bond is the link; the peptide is the whole chain.
- Peptide vs protein. Proteins are usually longer and fold into stable three-dimensional structures; short peptides often do not [1].
- Peptide vs peptide sequence. The sequence is the written description of the order of residues, not the molecule itself. See Understanding Peptide Sequences.
How Is a Peptide's Identity Documented?
Documenting a peptide's identity takes two steps: state the sequence, then show that the actual material matches it. Mass spectrometry usually covers identity, and HPLC covers purity.
The mass spectrum gives a molecular mass, and that number should agree with the mass calculated from the sequence, terminal modifications included. HPLC testing separates the main peptide from related impurities such as truncated or deletion sequences. On a Certificate of Analysis the two results sit on separate lines. Our guide to reading a COA walks through each one, and the Peptide Testing hub shows how the methods fit together.
Vinnix peptides are sold for laboratory research only. This article covers terminology and chemistry, and it does not describe any use in humans or animals.
FAQFrequently asked questions
What is a peptide in simple terms?
A peptide is a short chain of amino acids held together by peptide bonds. Picture beads on a string: the amino acids are the beads and the bonds are the links. The order of the beads is the sequence. Shuffle them and you get a different molecule, even though the same amino acids are all still there.
What is the smallest peptide?
The smallest peptide is a dipeptide: two amino acids joined by a single peptide bond. A single amino acid on its own is not a peptide, because the peptide definition requires at least one peptide bond. Tripeptides such as KPV and glutathione are the next size up, with three residues and two bonds.
Is a peptide a protein?
Not usually. Both are chains of amino acids linked by peptide bonds, but proteins are generally longer and fold into stable structures, while peptides are shorter. The line between them is a convention, often placed around 40 to 50 residues, so some molecules near the boundary are described both ways in the literature.
What is the difference between a peptide and a polypeptide?
A polypeptide is a long, unbranched chain of amino acids; a peptide is usually a shorter chain. Chemically, every polypeptide is a peptide. The word is just normally kept for chains long enough to approach protein size, and for the individual chains that make up a multi-chain protein.
Are all peptides made of the 20 standard amino acids?
No. Natural peptides are mostly built from the standard set, but synthetic peptides often include D-amino acids, non-standard residues such as aminoisobutyric acid (Aib), and modified ends such as a C-terminal amide. None of this breaks the peptide definition, but these features are part of the molecule's identity and must appear in its written structure.
How do you confirm that a sample is the right peptide?
Two checks do most of the work. Mass spectrometry gives a measured molecular mass to compare against the mass calculated from the stated sequence, and HPLC shows how much of the sample is the main peptide versus related impurities. Both results, tied to a specific batch, normally appear on a Certificate of Analysis.
REFScientific references
-
Alberts B, Johnson A, Lewis J, Raff M, Roberts K, Walter P. Molecular Biology of the Cell. 4th ed. New York: Garland Science; 2002. The Shape and Structure of Proteins. NCBI Bookshelf NBK26830. Source
textbook (NCBI Bookshelf) -
IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN). Nomenclature and symbolism for amino acids and peptides. Recommendations 1983. Eur J Biochem. 1984;138(1):9-37. PubMed 6692818
nomenclature standard -
Lee C, Zeng J, Drew BG, et al. The mitochondrial-derived peptide MOTS-c promotes metabolic homeostasis and reduces obesity and insulin resistance. Cell Metab. 2015;21(3):443-454. PubMed 25738459
in vitro and animal study (cited here for sequence origin only)
Research Library: Peptide Fundamentals
Testing & Analysis